Review



ll37 peptide  (Thermo Fisher)


Bioz Verified Symbol Thermo Fisher is a verified supplier
Bioz Manufacturer Symbol Thermo Fisher manufactures this product  
  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
    • 90
      Buy from Supplier

    Structured Review

    Thermo Fisher ll37 peptide
    Ll37 Peptide, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/ll37 peptide/product/Thermo Fisher
    Average 90 stars, based on 1 article reviews
    ll37 peptide - by Bioz Stars, 2026-02
    90/100 stars

    Images



    Similar Products

    human antimicrobial peptide ll37  (Yeasen Biotechnology)
    90
    Yeasen Biotechnology human antimicrobial peptide ll37
    Human Antimicrobial Peptide Ll37, supplied by Yeasen Biotechnology, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/human antimicrobial peptide ll37/product/Yeasen Biotechnology
    Average 90 stars, based on 1 article reviews
    human antimicrobial peptide ll37 - by Bioz Stars, 2026-02
    90/100 stars
    		  Buy from Supplier
    ll37 peptide  (Sangon Biotech)
    90
    Sangon Biotech ll37 peptide
    Ll37 Peptide, supplied by Sangon Biotech, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/ll37 peptide/product/Sangon Biotech
    Average 90 stars, based on 1 article reviews
    ll37 peptide - by Bioz Stars, 2026-02
    90/100 stars
    		  Buy from Supplier
    antimicrobial peptide ll37  (Sangon Biotech)
    90
    Sangon Biotech antimicrobial peptide ll37
    Antimicrobial Peptide Ll37, supplied by Sangon Biotech, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/antimicrobial peptide ll37/product/Sangon Biotech
    Average 90 stars, based on 1 article reviews
    antimicrobial peptide ll37 - by Bioz Stars, 2026-02
    90/100 stars
    		  Buy from Supplier
    antimicrobial peptide ll37  (AnaSpec)
    90
    AnaSpec antimicrobial peptide ll37
    Antimicrobial Peptide Ll37, supplied by AnaSpec, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/antimicrobial peptide ll37/product/AnaSpec
    Average 90 stars, based on 1 article reviews
    antimicrobial peptide ll37 - by Bioz Stars, 2026-02
    90/100 stars
    		  Buy from Supplier
    ll37 antimicrobial peptide ([LL-37, 37 aa]  (GenScript corporation)
    90
    GenScript corporation ll37 antimicrobial peptide ([LL-37, 37 aa]
    Ll37 Antimicrobial Peptide ([LL-37, 37 aa], supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/ll37 antimicrobial peptide ([LL-37, 37 aa]/product/GenScript corporation
    Average 90 stars, based on 1 article reviews
    ll37 antimicrobial peptide ([LL-37, 37 aa] - by Bioz Stars, 2026-02
    90/100 stars
    		  Buy from Supplier
    cathelicidin antimicrobial peptide ll37  (Innovagen AB)
    90
    Innovagen AB cathelicidin antimicrobial peptide ll37
    <t>Antimicrobial</t> activity of Py-cPen and V-cPen in vitro . VCA was used to analyze the antibacterial effects of Py-cPen (5, 10, and 30 μM) and V-cPen (1, 3, 10, and μM). <t>LL37</t> (1 μM) was used as a positive control, and untreated (using TRIS) bacteria were used as a negative control. The concentration of bacteria ( E. coli , P. aeruginosa , and S. aureus ) was 2 × 10 6 CFU/mL, and each sample was treated for 2 h. Data are presented as the mean ± SEM of four independent experiments ( n = 4). Statistical analysis was performed using a one-way ANOVA with Dunnett’s multiple comparison tests. Results are reported as ns = not significant, * p < 0.05, ** p < 0.01, *** p < 0.001, and **** p < 0.0001.
    Cathelicidin Antimicrobial Peptide Ll37, supplied by Innovagen AB, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/cathelicidin antimicrobial peptide ll37/product/Innovagen AB
    Average 90 stars, based on 1 article reviews
    cathelicidin antimicrobial peptide ll37 - by Bioz Stars, 2026-02
    90/100 stars
    		  Buy from Supplier
    ll37 peptide  (Thermo Fisher)
    90
    Thermo Fisher ll37 peptide
    <t>Antimicrobial</t> activity of Py-cPen and V-cPen in vitro . VCA was used to analyze the antibacterial effects of Py-cPen (5, 10, and 30 μM) and V-cPen (1, 3, 10, and μM). <t>LL37</t> (1 μM) was used as a positive control, and untreated (using TRIS) bacteria were used as a negative control. The concentration of bacteria ( E. coli , P. aeruginosa , and S. aureus ) was 2 × 10 6 CFU/mL, and each sample was treated for 2 h. Data are presented as the mean ± SEM of four independent experiments ( n = 4). Statistical analysis was performed using a one-way ANOVA with Dunnett’s multiple comparison tests. Results are reported as ns = not significant, * p < 0.05, ** p < 0.01, *** p < 0.001, and **** p < 0.0001.
    Ll37 Peptide, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/ll37 peptide/product/Thermo Fisher
    Average 90 stars, based on 1 article reviews
    ll37 peptide - by Bioz Stars, 2026-02
    90/100 stars
    		  Buy from Supplier
    ll37 peptide  (Magainin Pharmaceuticals Inc)
    90
    Magainin Pharmaceuticals Inc ll37 peptide
    <t>Antimicrobial</t> activity of Py-cPen and V-cPen in vitro . VCA was used to analyze the antibacterial effects of Py-cPen (5, 10, and 30 μM) and V-cPen (1, 3, 10, and μM). <t>LL37</t> (1 μM) was used as a positive control, and untreated (using TRIS) bacteria were used as a negative control. The concentration of bacteria ( E. coli , P. aeruginosa , and S. aureus ) was 2 × 10 6 CFU/mL, and each sample was treated for 2 h. Data are presented as the mean ± SEM of four independent experiments ( n = 4). Statistical analysis was performed using a one-way ANOVA with Dunnett’s multiple comparison tests. Results are reported as ns = not significant, * p < 0.05, ** p < 0.01, *** p < 0.001, and **** p < 0.0001.
    Ll37 Peptide, supplied by Magainin Pharmaceuticals Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/ll37 peptide/product/Magainin Pharmaceuticals Inc
    Average 90 stars, based on 1 article reviews
    ll37 peptide - by Bioz Stars, 2026-02
    90/100 stars
    		  Buy from Supplier

    Image Search Results


    Antimicrobial activity of Py-cPen and V-cPen in vitro . VCA was used to analyze the antibacterial effects of Py-cPen (5, 10, and 30 μM) and V-cPen (1, 3, 10, and μM). LL37 (1 μM) was used as a positive control, and untreated (using TRIS) bacteria were used as a negative control. The concentration of bacteria ( E. coli , P. aeruginosa , and S. aureus ) was 2 × 10 6 CFU/mL, and each sample was treated for 2 h. Data are presented as the mean ± SEM of four independent experiments ( n = 4). Statistical analysis was performed using a one-way ANOVA with Dunnett’s multiple comparison tests. Results are reported as ns = not significant, * p < 0.05, ** p < 0.01, *** p < 0.001, and **** p < 0.0001.

    Journal: Frontiers in Medicine

    Article Title: Investigating antibacterial and anti-inflammatory properties of synthetic curcuminoids

    doi: 10.3389/fmed.2024.1478122

    Figure Lengend Snippet: Antimicrobial activity of Py-cPen and V-cPen in vitro . VCA was used to analyze the antibacterial effects of Py-cPen (5, 10, and 30 μM) and V-cPen (1, 3, 10, and μM). LL37 (1 μM) was used as a positive control, and untreated (using TRIS) bacteria were used as a negative control. The concentration of bacteria ( E. coli , P. aeruginosa , and S. aureus ) was 2 × 10 6 CFU/mL, and each sample was treated for 2 h. Data are presented as the mean ± SEM of four independent experiments ( n = 4). Statistical analysis was performed using a one-way ANOVA with Dunnett’s multiple comparison tests. Results are reported as ns = not significant, * p < 0.05, ** p < 0.01, *** p < 0.001, and **** p < 0.0001.

    Article Snippet: Cathelicidin antimicrobial peptide LL37 was purchased from Innovagen (United States) ( , ).

    Techniques: Activity Assay, In Vitro, Positive Control, Bacteria, Negative Control, Concentration Assay, Comparison

    Visualization of E. coli , P. aeruginosa , and S. aureus viability. LIVE/DEAD Viability Assay of Gram-negative and Gram-positive bacteria stimulated with Py-cPen (10 μM) or V-cPen (3 μM), 10 mM Tris buffer at pH 7.4 as a negative control and LL37 (1 μM) as a positive control. Representative images for each independent experiment are presented ( n = 4). Live bacteria were stained with green SYTO 9 nucleic acid fluorescent dye, and dead bacteria were stained with red propidium iodine dye.

    Journal: Frontiers in Medicine

    Article Title: Investigating antibacterial and anti-inflammatory properties of synthetic curcuminoids

    doi: 10.3389/fmed.2024.1478122

    Figure Lengend Snippet: Visualization of E. coli , P. aeruginosa , and S. aureus viability. LIVE/DEAD Viability Assay of Gram-negative and Gram-positive bacteria stimulated with Py-cPen (10 μM) or V-cPen (3 μM), 10 mM Tris buffer at pH 7.4 as a negative control and LL37 (1 μM) as a positive control. Representative images for each independent experiment are presented ( n = 4). Live bacteria were stained with green SYTO 9 nucleic acid fluorescent dye, and dead bacteria were stained with red propidium iodine dye.

    Article Snippet: Cathelicidin antimicrobial peptide LL37 was purchased from Innovagen (United States) ( , ).

    Techniques: Viability Assay, Bacteria, Negative Control, Positive Control, Staining

    Inhibition of NF-κB activation using Py-cPen and V-cPen. (A) THP-1XBlue-CD14 cells were treated with Py-cPen (10–30 μM). In the case of Py-cPen, there is a significant reduction in the activation of NF-κB. (B) THP-1XBlue-CD14 cells were also treated with V-cPen (3–10 μM). V-cPen yielded the enhancement of NF-κB activation. LL37 (1 μM) was used as a positive control. The MTT viability assay was used to analyze the toxic effects of Py-cPen and V-cPen on THP-1XBlue-CD14 cells. Data are presented as the mean ± SEM of four independent experiments ( n = 4). Statistical analysis was performed using a one-way ANOVA with Dunnett’s multiple comparison tests. Results are reported as ns = not significant and **** p < 0.0001.

    Journal: Frontiers in Medicine

    Article Title: Investigating antibacterial and anti-inflammatory properties of synthetic curcuminoids

    doi: 10.3389/fmed.2024.1478122

    Figure Lengend Snippet: Inhibition of NF-κB activation using Py-cPen and V-cPen. (A) THP-1XBlue-CD14 cells were treated with Py-cPen (10–30 μM). In the case of Py-cPen, there is a significant reduction in the activation of NF-κB. (B) THP-1XBlue-CD14 cells were also treated with V-cPen (3–10 μM). V-cPen yielded the enhancement of NF-κB activation. LL37 (1 μM) was used as a positive control. The MTT viability assay was used to analyze the toxic effects of Py-cPen and V-cPen on THP-1XBlue-CD14 cells. Data are presented as the mean ± SEM of four independent experiments ( n = 4). Statistical analysis was performed using a one-way ANOVA with Dunnett’s multiple comparison tests. Results are reported as ns = not significant and **** p < 0.0001.

    Article Snippet: Cathelicidin antimicrobial peptide LL37 was purchased from Innovagen (United States) ( , ).

    Techniques: Inhibition, Activation Assay, Positive Control, MTT Viability Assay, Comparison